Anti-CXCL8, Rabbit, Polyclonal
Catalog Number:
ATA-HPA057179
- Images (11)
| Article Name: | Anti-CXCL8, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA057179 |
| Supplier Catalog Number: | HPA057179 |
| Alternative Catalog Number: | ATA-HPA057179-25,ATA-HPA057179-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | 3-10C, AMCF-I, b-ENAP, GCP-1, GCP1, IL-8, IL8, K60, LECT, LUCT, LYNAP, MDNCF, MONAP, NAF, NAP-1, NAP1, SCYB8, TSG-1 |
| chemokine (C-X-C motif) ligand 8 |
Anti-CXCL8
|
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 3576 |
| UniProt: | P10145 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKF |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CXCL8 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus. |
|
|
Immunohistochemical staining of human rectum shows moderate positivity in plasma. |
|
|
Immunohistochemical staining of human placenta shows moderate positivity in plasma. |
|
|
Immunohistochemical staining of human lymph node shows weak to moderate cytoplasmic positivity in a subset of non-germinal center cells. |
|
|
Immunohistochemical staining of human fallopian tube shows no positivity in glandular cells as expected. |
|
|
Western blot analysis in human cell line EFO-21. |
|
|
|
|
|
|
|
|
HPA057179 |
|
|
HPA057179 |
|
|
HPA057179 |
Product Guarantee and Expert Support
