Anti-CXCL8 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-CXCL8 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA057179
• Supplier Catalog Number: HPA057179
• Alternative Catalog Number: ATA-HPA057179-100,ATA-HPA057179-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: 3-10C, AMCF-I, b-ENAP, GCP-1, GCP1, IL-8, IL8, K60, LECT, LUCT, LYNAP, MDNCF, MONAP, NAF, NAP-1, NAP1, SCYB8, TSG-1

Product Description

chemokine (C-X-C motif) ligand 8

Additional Information

Anti-CXCL8

Product Properties

• Clonality: Polyclonal
• Concentration: 0.2 mg/ml
• Isotype: IgG
• NCBI: 3576
• UniProt: P10145
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKF
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: CXCL8
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml

Images

Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.

Immunohistochemical staining of human rectum shows moderate positivity in plasma.

Immunohistochemical staining of human placenta shows moderate positivity in plasma.

Immunohistochemical staining of human lymph node shows weak to moderate cytoplasmic positivity in a subset of non-germinal center cells.

Immunohistochemical staining of human fallopian tube shows no positivity in glandular cells as expected.

Western blot analysis in human cell line EFO-21.

HPA057179

HPA057179

HPA057179