Anti-IDH1, Rabbit, Polyclonal
Catalog Number:
ATA-HPA057936
- Images (9)
| Article Name: | Anti-IDH1, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA057936 |
| Supplier Catalog Number: | HPA057936 |
| Alternative Catalog Number: | ATA-HPA057936-25,ATA-HPA057936-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | Pan-Cancer |
| isocitrate dehydrogenase 1 (NADP+), soluble |
| Anti-IDH1 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 3417 |
| UniProt: | O75874 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LAHRAKLDNNKELAFFALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | IDH1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human prostate and skeletal muscle tissues using Anti-IDH1 antibody. Corresponding IDH1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human prostate shows high expression. |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
Western blot analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-IDH1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB. |
|
|
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human cell line HepG2 |
|
|
|
|
|
HPA057936 |
|
|
HPA057936 |
|
|
HPA057936 |
Product Guarantee and Expert Support
