Anti-N6AMT1, Rabbit, Polyclonal
Catalog Number:
ATA-HPA059242
| Article Name: |
Anti-N6AMT1, Rabbit, Polyclonal |
| Biozol Catalog Number: |
ATA-HPA059242 |
| Supplier Catalog Number: |
HPA059242 |
| Alternative Catalog Number: |
ATA-HPA059242-25,ATA-HPA059242-100 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
ICC |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: |
Unconjugated |
| Alternative Names: |
C21orf127, HEMK2, MTQ2, N6AMT, PRED28 |
| N-6 adenine-specific DNA methyltransferase 1 (putative) |
| Clonality: |
Polyclonal |
| Isotype: |
IgG |
| NCBI: |
29104 |
| UniProt: |
Q9Y5N5 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: |
GREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFT |
| Target: |
N6AMT1 |
| Antibody Type: |
Monoclonal Antibody |
| Application Dilute: |
ICC-IF: 0.25-2 µg/ml |
![]()
|
HPA059242 |
