Anti-MLH1, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-MLH1, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA060714
• Supplier Catalog Number: HPA060714
• Alternative Catalog Number: ATA-HPA060714-25,ATA-HPA060714-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: COCA2, FCC2, HNPCC, HNPCC2, Pan-Cancer

Product Description

mutL homolog 1

Additional Information

Anti-MLH1

Product Properties

• Clonality: Polyclonal
• Isotype: IgG
• NCBI: 4292
• UniProt: P40692
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: IATRRKALKNPSEEYGKILEVVGRYSVHGISFSVKKQGETVADVRTLPSTVDNIRSIFGVSRELIEIGCEDKTLAFKMNGYISNYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNV
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: MLH1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml

Images

Immunofluorescent staining of human cell line RH-30 shows localization to nucleoplasm.

HPA060714