Anti-CD5, Rabbit, Polyclonal
Catalog Number:
ATA-HPA060839
- Images (6)
| Article Name: | Anti-CD5, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA060839 |
| Supplier Catalog Number: | HPA060839 |
| Alternative Catalog Number: | ATA-HPA060839-25,ATA-HPA060839-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | LEU1, T1, Pan-Cancer |
| CD5 molecule |
| Anti-CD5 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 921 |
| UniProt: | P06127 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | GFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCQEQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVT |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CD5 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human lymph node and cerebral cortex tissues using Anti-CD5 antibody. Corresponding CD5 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human lymph node shows high expression. |
|
|
Immunohistochemical staining of human cerebral cortex shows low expression as expected. |
|
|
HPA060839 |
|
|
HPA060839 |
|
|
HPA060839 |
Product Guarantee and Expert Support
