Anti-ITGA2, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-ITGA2, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA060991
• Supplier Catalog Number: HPA060991
• Alternative Catalog Number: ATA-HPA060991-25,ATA-HPA060991-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: CD49B, Pan-Cancer

Product Description

integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor)

Additional Information

Anti-ITGA2

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 3673
• UniProt: P17301
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: SSSVSFKSENFRHTKELNCRTASCSNVTCWLKDVHMKGEYFVNVTTRIWNGTFASSTFQTVQLTAAAEINTYNPEIYVIEDNTVTIPLMIMKPDE
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: ITGA2
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:20 - 1:50

Images

Immunohistochemical staining of human endometrium, rectum, skin and urinary bladder using Anti-ITGA2 antibody HPA060991 (A) shows similar protein distribution across tissues to independent antibody HPA063556 (B).

Immunohistochemical staining of human liver shows weak membranous positivity in hepatocytes.

Immunohistochemical staining of human urinary bladder shows moderate to strong membranous positivity in urothelial cells.

Immunohistochemical staining of human rectum shows moderate to strong membranous positivity in glandular cells.

Immunohistochemical staining of human endometrium shows moderate to strong membranous positivity in glandular cells.

Immunohistochemical staining of human skin shows moderate to strong membranous positivity in squamous epithelial cells.

HPA060991

HPA060991

HPA060991