Anti-GAPDH, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-GAPDH, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA061280
• Supplier Catalog Number: HPA061280
• Alternative Catalog Number: ATA-HPA061280-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: GAPD, Pan-Cancer

Product Description

glyceraldehyde-3-phosphate dehydrogenase

Additional Information

Anti-GAPDH

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05 mg/ml
• Isotype: IgG
• NCBI: 2597
• UniProt: P04406
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: EKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAG
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: GAPDH
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, WB: 0.04-0.4 µg/ml

Images

Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear membrane, plasma membrane & cytosol.

Western blot analysis using Anti-GAPDH antibody HPA061280 (A) shows similar pattern to independent antibody HPA040067 (B).

HPA061280

HPA061280