Anti-VEGFA, Rabbit, Polyclonal
Catalog Number:
ATA-HPA069116
- Images (4)
| Article Name: | Anti-VEGFA, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA069116 |
| Supplier Catalog Number: | HPA069116 |
| Alternative Catalog Number: | ATA-HPA069116-25,ATA-HPA069116-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | VEGF, VEGF-A, VPF, Pan-Cancer |
| vascular endothelial growth factor A |
| Anti-VEGFA |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 7422 |
| UniProt: | P15692 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | KWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | VEGFA |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human breast shows cytoplasmic positivity in adipocytes. |
|
|
HPA069116 |
|
|
HPA069116 |
|
|
HPA069116 |
Product Guarantee and Expert Support
