Anti-VCAM1, Rabbit, Polyclonal

Catalog Number: ATA-HPA069867
Article Name: Anti-VCAM1, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA069867
Supplier Catalog Number: HPA069867
Alternative Catalog Number: ATA-HPA069867-25,ATA-HPA069867-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CD106, Pan-Cancer
vascular cell adhesion molecule 1
Anti-VCAM1
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 7412
UniProt: P19320
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVIEDIGKVLVCRAKLHIDEMDSVPT
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: VCAM1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to cell junctions.
Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
HPA069867
HPA069867