Anti-BRAF, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-BRAF, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA071048
• Supplier Catalog Number: HPA071048
• Alternative Catalog Number: ATA-HPA071048-25,ATA-HPA071048-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: BRAF1, Pan-Cancer

Product Description

B-Raf proto-oncogene, serine/threonine kinase

Additional Information

Anti-BRAF

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 673
• UniProt: P15056
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: ADPAIPEEVWNIKQMIKLTQEHIEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQL
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: BRAF
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, WB: 0.04-0.4 µg/ml

Images

Immunofluorescent staining of human cell line SiHa shows localization to vesicles.

Western blot analysis in human cell line RT-4 and human cell line U-251 MG.

HPA071048

HPA071048