Recombinant Mouse Apolipoprotein E (Apoe), Unconjugated

Product Overview

• Article Name: Recombinant Mouse Apolipoprotein E (Apoe), Unconjugated
• Biozol Catalog Number: BIM-RPC20004
• Supplier Catalog Number: RPC20004
• Alternative Catalog Number: BIM-RPC20004-20UG, BIM-RPC20004-100UG, BIM-RPC20004-1MG
• Manufacturer: Biomatik Corporation
• Category: Proteine/Peptide
• Species Reactivity: Mouse
• Conjugation: Unconjugated
• Alternative Names: ApoeApolipoprotein E, Apo-E

Product Description

Recombinant Mouse Apolipoprotein E (Apoe) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Apoe. Target Synonyms: ApoeApolipoprotein E, Apo-

Product Properties

• Molecular Weight: 38kDa
• Tag: N-Terminal 6Xhis-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% as determined by SDS-PAGE
• Sequence: EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLK
• Target: Apoe