Recombinant Human Aquaporin-4 (AQP4), partial, Unconjugated

Product Overview

• Article Name: Recombinant Human Aquaporin-4 (AQP4), partial, Unconjugated
• Biozol Catalog Number: BIM-RPC20006
• Supplier Catalog Number: RPC20006
• Alternative Catalog Number: BIM-RPC20006-20UG, BIM-RPC20006-100UG, BIM-RPC20006-1MG
• Manufacturer: Biomatik Corporation
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: Mercurial-insensitive water channel, MIWCWCH4

Product Description

Recombinant Human Aquaporin-4 (AQP4), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: AQP4. Target Synonyms: Mercurial-insensitive

Product Properties

• Molecular Weight: 24kDa
• Tag: N-Terminal 6Xhis-Sumo-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% as determined by SDS-PAGE
• Sequence: CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV
• Target: AQP4