Recombinant Human ATP synthase subunit delta, mitochondrial (ATP5D), Unconjugated

Product Overview

• Article Name: Recombinant Human ATP synthase subunit delta, mitochondrial (ATP5D), Unconjugated
• Biozol Catalog Number: BIM-RPC20008
• Supplier Catalog Number: RPC20008
• Alternative Catalog Number: BIM-RPC20008-20UG, BIM-RPC20008-100UG, BIM-RPC20008-1MG
• Manufacturer: Biomatik Corporation
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: F-ATPase delta subunit

Product Description

Recombinant Human ATP synthase subunit delta, mitochondrial (ATP5D) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: ATP5D. Target Synonyms:

Product Properties

• Molecular Weight: 31kDa
• Tag: N-Terminal 6Xhis-Sumo-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% as determined by SDS-PAGE
• Sequence: AEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANEALVKALE
• Target: ATP5D