Recombinant Human Renin receptor (ATP6AP2), Unconjugated

Catalog Number: BIM-RPC20009
Article Name: Recombinant Human Renin receptor (ATP6AP2), Unconjugated
Biozol Catalog Number: BIM-RPC20009
Supplier Catalog Number: RPC20009
Alternative Catalog Number: BIM-RPC20009-20UG, BIM-RPC20009-100UG, BIM-RPC20009-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: ATPase H(+)-transporting lysosomal accessory protein 2ATPase H(+)-transporting lysosomal-interacting protein 2ER-localized type I transmembrane adaptorEmbryonic liver differentiation factor 10N14FRenin/prorenin receptorVacuolar ATP synthase membrane sect
Recombinant Human Renin receptor (ATP6AP2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: ATP6AP2. Target Synonyms: ATPase H(+)-transporti
Molecular Weight: 41.5kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFD
Target: ATP6AP2