Recombinant Rat Osteocalcin (Bglap), Unconjugated

Catalog Number: BIM-RPC20010
Article Name: Recombinant Rat Osteocalcin (Bglap), Unconjugated
Biozol Catalog Number: BIM-RPC20010
Supplier Catalog Number: RPC20010
Alternative Catalog Number: BIM-RPC20010-20UG, BIM-RPC20010-100UG, BIM-RPC20010-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Rat
Conjugation: Unconjugated
Alternative Names: Bone Gla protein, BGPGamma-carboxyglutamic acid-containing protein
Recombinant Rat Osteocalcin (Bglap) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus). Target Name: Bglap. Target Synonyms: Bone Gla protein, BGPGamma-c
Molecular Weight: 32.6kDa
Tag: N-Terminal Gst-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: YLNNGLGAPAPYPDPLEPHREVCELNPNCDELADHIGFQDAYKRIYGTTV
Target: Bglap