Recombinant Human Bone morphogenetic protein 4 (BMP4), Unconjugated

Product Overview

• Article Name: Recombinant Human Bone morphogenetic protein 4 (BMP4), Unconjugated
• Biozol Catalog Number: BIM-RPC20011
• Supplier Catalog Number: RPC20011
• Alternative Catalog Number: BIM-RPC20011-20UG, BIM-RPC20011-100UG, BIM-RPC20011-1MG
• Manufacturer: Biomatik Corporation
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: Bone morphogenetic protein 2B, BMP-2B

Product Description

Recombinant Human Bone morphogenetic protein 4 (BMP4) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: BMP4. Target Synonyms: Bone morphogen

Product Properties

• Molecular Weight: 29.1kDa
• Tag: N-Terminal 6Xhis-Sumo-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% as determined by SDS-PAGE
• Sequence: SPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
• Target: BMP4