Recombinant Human Lys-63-specific deubiquitinase BRCC36 (BRCC3), Unconjugated

Product Overview

• Article Name: Recombinant Human Lys-63-specific deubiquitinase BRCC36 (BRCC3), Unconjugated
• Biozol Catalog Number: BIM-RPC20012
• Supplier Catalog Number: RPC20012
• Alternative Catalog Number: BIM-RPC20012-20UG, BIM-RPC20012-100UG, BIM-RPC20012-1MG
• Manufacturer: Biomatik Corporation
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: BRCA1-A complex subunit BRCC36BRCA1/BRCA2-containing complex subunit 3BRCA1/BRCA2-containing complex subunit 36BRISC complex subunit BRCC36

Product Description

Recombinant Human Lys-63-specific deubiquitinase BRCC36 (BRCC3) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: BRCC3. Target Synonyms: BRC

Product Properties

• Molecular Weight: 51.9kDa
• Tag: N-Terminal 6Xhis-Sumo-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% as determined by SDS-PAGE
• Sequence: AVQVVQAVQAVHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDTRSDSKFAYTGTEMRTVAEKVDAVRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSHPHITVWPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQAQKSSESLHGPRDFWSSSQHISIEGQKEEERYERIEIPIHIVPHVTIGKVCLESAVELPKILCQEEQDAYRRIHSLTH
• Target: BRCC3