Recombinant Rat Carbonic anhydrase 1 (Ca1), Unconjugated

Catalog Number: BIM-RPC20015
Article Name: Recombinant Rat Carbonic anhydrase 1 (Ca1), Unconjugated
Biozol Catalog Number: BIM-RPC20015
Supplier Catalog Number: RPC20015
Alternative Catalog Number: BIM-RPC20015-20UG, BIM-RPC20015-100UG, BIM-RPC20015-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Rat
Conjugation: Unconjugated
Alternative Names: Carbonate dehydratase I
Recombinant Rat Carbonic anhydrase 1 (Ca1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus). Target Name: Ca1. Target Synonyms: Carbonate dehydratase I
Molecular Weight: 44.2kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: ASADWGYDSKNGPDQWSKLYPIANGNNQSPIDIKTSEAKHDSSLKPVSVSYNPATAKEIVNVGHSFHVVFDDSSNQSVLKGGPLADSYRLTQFHFHWGNSNDHGSEHTVDGAKYSGELHLVHWNSAKYSSAAEAISKADGLAIIGVLMKVGPANPNLQKVLDALSSVKTKGKRAPFTNFDPSSLLPSSLDYWTYFGSLTHPPLHESVTWVICKESISLSPEQLAQLRGLLSSAEGEPAVPVLSNHRPPQPLKGR
Target: Ca1