Recombinant Human Cystathionine beta-synthase (CBS), partial, Unconjugated

Catalog Number: BIM-RPC20017
Article Name: Recombinant Human Cystathionine beta-synthase (CBS), partial, Unconjugated
Biozol Catalog Number: BIM-RPC20017
Supplier Catalog Number: RPC20017
Alternative Catalog Number: BIM-RPC20017-20UG, BIM-RPC20017-100UG, BIM-RPC20017-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Beta-thionase, Serine sulfhydrase
Recombinant Human Cystathionine beta-synthase (CBS), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CBS. Target Synonyms: Beta-thi
Molecular Weight: 64.5kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: PSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASV
Target: CBS