Recombinant Mouse H-2 class II histocompatibility antigen gamma chain (Cd74), partial, Unconjugated

Product Overview

• Article Name: Recombinant Mouse H-2 class II histocompatibility antigen gamma chain (Cd74), partial, Unconjugated
• Biozol Catalog Number: BIM-RPC20020
• Supplier Catalog Number: RPC20020
• Alternative Catalog Number: BIM-RPC20020-20UG, BIM-RPC20020-100UG, BIM-RPC20020-1MG
• Manufacturer: Biomatik Corporation
• Category: Proteine/Peptide
• Species Reactivity: Mouse
• Conjugation: Unconjugated
• Alternative Names: Ia antigen-associated invariant chain, IiMHC class II-associated invariant chain, CD74

Product Description

Recombinant Mouse H-2 class II histocompatibility antigen gamma chain (Cd74), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Cd74.

Product Properties

• Molecular Weight: 29.4kDa
• Tag: N-Terminal 6Xhis-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% as determined by SDS-PAGE
• Sequence: QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKVLTKCQEEVSHIPAVYPGAFRPKCDENGNYLPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDLSSGLGVTRQELGQVTL
• Target: Cd74