Recombinant Human CD81 antigen (CD81), partial, Unconjugated

Catalog Number: BIM-RPC20021
Article Name: Recombinant Human CD81 antigen (CD81), partial, Unconjugated
Biozol Catalog Number: BIM-RPC20021
Supplier Catalog Number: RPC20021
Alternative Catalog Number: BIM-RPC20021-20UG, BIM-RPC20021-100UG, BIM-RPC20021-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: 26 kDa cell surface protein TAPA-1Target of the antiproliferative antibody 1Tetraspanin-28, Tspan-28, CD81
Recombinant Human CD81 antigen (CD81), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CD81. Target Synonyms: 26 kDa cell surface p
Molecular Weight: 25.8kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK
Target: CD81