Recombinant Tetronarce californica Acetylcholine receptor subunit alpha (CHRNA1), partial, Unconjugated

Catalog Number: BIM-RPC20026
Article Name: Recombinant Tetronarce californica Acetylcholine receptor subunit alpha (CHRNA1), partial, Unconjugated
Biozol Catalog Number: BIM-RPC20026
Supplier Catalog Number: RPC20026
Alternative Catalog Number: BIM-RPC20026-20UG, BIM-RPC20026-100UG, BIM-RPC20026-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Conjugation: Unconjugated
Alternative Names: CHRNA1, Acetylcholine receptor subunit alpha
Recombinant Tetronarce californica Acetylcholine receptor subunit alpha (CHRNA1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Tetronarce californica (Pacific elec
Molecular Weight: 40.8kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: SEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQLIQLISVDEVNQIVETNVRLRQQWIDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNADGDFAIVHMTKLLLDYTGKIMWTPPAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKVSISPESDRPDLSTFMESGEWVMKDYRGWKHWVYYTCCPDTPYLDITYHFIMQRI
Target: CHRNA1