Recombinant Human Steroid 21-hydroxylase (CYP21A2), Unconjugated

Product Overview

• Article Name: Recombinant Human Steroid 21-hydroxylase (CYP21A2), Unconjugated
• Biozol Catalog Number: BIM-RPC20031
• Supplier Catalog Number: RPC20031
• Alternative Catalog Number: BIM-RPC20031-20UG, BIM-RPC20031-100UG, BIM-RPC20031-1MG
• Manufacturer: Biomatik Corporation
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: 21-OHaseCytochrome P-450c21Cytochrome P450 21Cytochrome P450 XXICytochrome P450-C21Cytochrome P450-C21B

Product Description

Recombinant Human Steroid 21-hydroxylase (CYP21A2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CYP21A2. Target Synonyms: 21-OHaseCytoch

Product Properties

• Molecular Weight: 59.9kDa
• Tag: N-Terminal 6Xhis-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% as determined by SDS-PAGE
• Sequence: MLLLGLLLLPLLAGARLLWNWWKLRSLHLPPLAPGFLHLLQPDLPIYLLGLTQKFGPIYRLHLGLQDVVVLNSKRTIEEAMVKKWADFAGRPEPLTYKLVSKNYPDLSLGDYSLLWKAHKKLTRSALLLGIRDSMEPVVEQLTQEFCERMRAQPGTPVAIEEEFSLLTCSIICYLTFGDKIKDDNLMPAYYKCIQEVLKTWSHWSIQIVDVIPFLRFFPNPGLRRLKQAIEKRDHIVEMQLRQHKESLVAGQWR
• Target: CYP21A2