Recombinant Human IgG receptor FcRn large subunit p51 (FCGRT), partial, Unconjugated

Product Overview

• Article Name: Recombinant Human IgG receptor FcRn large subunit p51 (FCGRT), partial, Unconjugated
• Biozol Catalog Number: BIM-RPC20038
• Supplier Catalog Number: RPC20038
• Alternative Catalog Number: BIM-RPC20038-20UG, BIM-RPC20038-100UG, BIM-RPC20038-1MG
• Manufacturer: Biomatik Corporation
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: IgG Fc fragment receptor transporter alpha chainNeonatal Fc receptor

Product Description

Recombinant Human IgG receptor FcRn large subunit p51 (FCGRT), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: FCGRT. Target Synony

Product Properties

• Molecular Weight: 57.4kDa
• Tag: N-Terminal Gst-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% as determined by SDS-PAGE
• Sequence: AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIV
• Target: FCGRT