Recombinant Mouse Fibroblast growth factor 21 (Fgf21), Unconjugated

Product Overview

• Article Name: Recombinant Mouse Fibroblast growth factor 21 (Fgf21), Unconjugated
• Biozol Catalog Number: BIM-RPC20039
• Supplier Catalog Number: RPC20039
• Alternative Catalog Number: BIM-RPC20039-20UG, BIM-RPC20039-100UG, BIM-RPC20039-1MG
• Manufacturer: Biomatik Corporation
• Category: Proteine/Peptide
• Species Reactivity: Mouse
• Conjugation: Unconjugated
• Alternative Names: Fgf21Fibroblast growth factor 21, FGF-21

Product Description

Recombinant Mouse Fibroblast growth factor 21 (Fgf21) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Fgf21. Target Synonyms: Fgf21Fibrobla

Product Properties

• Molecular Weight: 23.9kDa
• Tag: N-Terminal 6Xhis-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% as determined by SDS-PAGE
• Sequence: AYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS
• Target: Fgf21