Recombinant Rat Fibroblast growth factor 23 (Fgf23), Unconjugated

Product Overview

• Article Name: Recombinant Rat Fibroblast growth factor 23 (Fgf23), Unconjugated
• Biozol Catalog Number: BIM-RPC20040
• Supplier Catalog Number: RPC20040
• Alternative Catalog Number: BIM-RPC20040-20UG, BIM-RPC20040-100UG, BIM-RPC20040-1MG
• Manufacturer: Biomatik Corporation
• Category: Proteine/Peptide
• Species Reactivity: Rat
• Conjugation: Unconjugated
• Alternative Names: Fgf23Fibroblast growth factor 23, FGF-23

Product Description

Recombinant Rat Fibroblast growth factor 23 (Fgf23) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus). Target Name: Fgf23. Target Synonyms: Fgf23Fibrobl

Product Properties

• Molecular Weight: 29.5kDa
• Tag: N-Terminal 6Xhis-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% as determined by SDS-PAGE
• Sequence: YSDTSPLLGSNWGSLTHLYTATARNSYHLQIHRDGHVDGTPHQTIYSALMITSEDAGSVVIIGAMTRRFLCMDLRGNIFGSYHFSPENCRFRQWTLENGYDVYLSPKHHYLVSLGRSKRIFQPGTNPPPFSQFLARRNEVPLLHFYTARPRRHTRSAEDPPERDPLNVLKPRPRATPIPVSCSRELPSAEEGGPAASDPLGVLRRGRGDARRGAGGTDRCRPFPRFV
• Target: Fgf23