Recombinant Human Glucagon-like peptide 1 receptor (GLP1R), partial, Unconjugated

Product Overview

• Article Name: Recombinant Human Glucagon-like peptide 1 receptor (GLP1R), partial, Unconjugated
• Biozol Catalog Number: BIM-RPC20043
• Supplier Catalog Number: RPC20043
• Alternative Catalog Number: BIM-RPC20043-20UG, BIM-RPC20043-100UG, BIM-RPC20043-1MG
• Manufacturer: Biomatik Corporation
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: GLP 1 R, GLP 1 receptor, GLP 1R, GLP, GLP-1 receptor, GLP-1-R, GLP-1R, GLP1R, GLP1R_HUMAN, Glucagon like peptide 1 receptor, Glucagon-like peptide 1 receptor, MGC138331, OTTHUMP00000016340

Product Description

Recombinant Human Glucagon-like peptide 1 receptor (GLP1R), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: GLP1R. Target Synonyms:

Product Properties

• Molecular Weight: 18.3kDa
• Tag: N-Terminal 6Xhis-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% as determined by SDS-PAGE
• Sequence: RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY
• Target: GLP1R