Recombinant Mouse Hyaluronan synthase 2 (Has2), partial, Unconjugated

Catalog Number: BIM-RPC20049
Article Name: Recombinant Mouse Hyaluronan synthase 2 (Has2), partial, Unconjugated
Biozol Catalog Number: BIM-RPC20049
Supplier Catalog Number: RPC20049
Alternative Catalog Number: BIM-RPC20049-20UG, BIM-RPC20049-100UG, BIM-RPC20049-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: Hyaluronate synthase 2Hyaluronic acid synthase 2, HA synthase 2
Recombinant Mouse Hyaluronan synthase 2 (Has2), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Has2. Target Synonyms: Hyaluronate
Molecular Weight: 51.9kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: EHRKMKKSLETPIKLNKTVALCIAAYQEDPDYLRKCLQSVKRLTYPGIKVVMVIDGNSDDDLYMMDIFSEVMGRDKSATYIWKNNFHEKGPGETEESHKESSQHVTQLVLSNKSICIMQKWGGKREVMYTAFRALGRSVDYVQVCDSDTMLDPASSVEMVKVLEEDPMVGGVGGDVQILNKYDSWISFLSSVRYWMAFNIERACQSYFGCVQCISGPLGMYRNSLLHEFVEDWYNQEFMGNQCSFGDDRHLTNR
Target: Has2