Recombinant Human Interferon alpha-14 (IFNA14), Unconjugated

Catalog Number: BIM-RPC20052
Article Name: Recombinant Human Interferon alpha-14 (IFNA14), Unconjugated
Biozol Catalog Number: BIM-RPC20052
Supplier Catalog Number: RPC20052
Alternative Catalog Number: BIM-RPC20052-20UG, BIM-RPC20052-100UG, BIM-RPC20052-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Interferon alpha-H
Recombinant Human Interferon alpha-14 (IFNA14) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: IFNA14. Target Synonyms: Interferon alpha-H.
Molecular Weight: 35.7kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: CNLSQTHSLNNRRTLMLMAQMRRISPFSCLKDRHDFEFPQEEFDGNQFQKAQAISVLHEMMQQTFNLFSTKNSSAAWDETLLEKFYIELFQQMNDLEACVIQEVGVEETPLMNEDSILAVKKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD
Target: IFNA14