Recombinant Human Galectin-9 (LGALS9), Unconjugated

Product Overview

• Article Name: Recombinant Human Galectin-9 (LGALS9), Unconjugated
• Biozol Catalog Number: BIM-RPC20057
• Supplier Catalog Number: RPC20057
• Alternative Catalog Number: BIM-RPC20057-20UG, BIM-RPC20057-100UG, BIM-RPC20057-1MG
• Manufacturer: Biomatik Corporation
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: Ecalectin, Tumor antigen HOM-HD-21

Product Description

Recombinant Human Galectin-9 (LGALS9) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: LGALS9. Target Synonyms: Ecalectin, Tumor antigen HOM

Product Properties

• Molecular Weight: 65.9kDa
• Tag: N-Terminal 6Xhis-Gst-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% as determined by SDS-PAGE
• Sequence: MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNS
• Target: LGALS9