Recombinant Human Peroxisome proliferator-activated receptor gamma (PPARG), Unconjugated

Catalog Number: BIM-RPC20064
Article Name: Recombinant Human Peroxisome proliferator-activated receptor gamma (PPARG), Unconjugated
Biozol Catalog Number: BIM-RPC20064
Supplier Catalog Number: RPC20064
Alternative Catalog Number: BIM-RPC20064-20UG, BIM-RPC20064-100UG, BIM-RPC20064-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Nuclear receptor subfamily 1 group C member 3
Recombinant Human Peroxisome proliferator-activated receptor gamma (PPARG) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: PPARG. Target Sy
Molecular Weight: 70.3kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: MTMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNS
Target: PPARG