Recombinant Human Perforin-1 (PRF1), Unconjugated

Product Overview

• Article Name: Recombinant Human Perforin-1 (PRF1), Unconjugated
• Biozol Catalog Number: BIM-RPC20065
• Supplier Catalog Number: RPC20065
• Alternative Catalog Number: BIM-RPC20065-20UG, BIM-RPC20065-100UG, BIM-RPC20065-1MG
• Manufacturer: Biomatik Corporation
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: Cytolysin, Lymphocyte pore-forming protein, PFP

Product Description

Recombinant Human Perforin-1 (PRF1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: PRF1. Target Synonyms: Cytolysin, Lymphocyte pore-formi

Product Properties

• Molecular Weight: 75.2kDa
• Tag: N-Terminal 6Xhis-Sumo-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% as determined by SDS-PAGE
• Sequence: PCHTAARSECKRSHKFVPGAWLAGEGVDVTSLRRSGSFPVDTQRFLRPDGTCTLCENALQEGTLQRLPLALTNWRAQGSGCQRHVTRAKVSSTEAVARDAARSIRNDWKVGLDVTPKPTSNVHVSVAGSHSQAANFAAQKTHQDQYSFSTDTVECRFYSFHVVHTPPLHPDFKRALGDLPHHFNASTQPAYLRLISNYGTHFIRAVELGGRISALTALRTCELALEGLTDNEVEDCLTVEAQVNIGIHGSISAE
• Target: PRF1