Recombinant Human Retinoschisin (RS1), Unconjugated

Product Overview

• Article Name: Recombinant Human Retinoschisin (RS1), Unconjugated
• Biozol Catalog Number: BIM-RPC20075
• Supplier Catalog Number: RPC20075
• Alternative Catalog Number: BIM-RPC20075-20UG, BIM-RPC20075-100UG, BIM-RPC20075-1MG
• Manufacturer: Biomatik Corporation
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: X-linked juvenile retinoschisis protein

Product Description

Recombinant Human Retinoschisin (RS1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: RS1. Target Synonyms: X-linked juvenile retinoschisis

Product Properties

• Molecular Weight: 27kDa
• Tag: N-Terminal 6Xhis-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% as determined by SDS-PAGE
• Sequence: STEDEGEDPWYQKACKCDCQGGPNALWSAGATSLDCIPECPYHKPLGFESGEVTPDQITCSNPEQYVGWYSSWTANKARLNSQGFGCAWLSKFQDSSQWLQIDLKEIKVISGILTQGRCDIDEWMTKYSVQYRTDERLNWIYYKDQTGNNRVFYGNSDRTSTVQNLLRPPIISRFIRLIPLGWHVRIAIRMELLECVSKCA
• Target: RS1