Recombinant Rat Protein S100-A8 (S100a8), Unconjugated

Catalog Number: BIM-RPC20079
Article Name: Recombinant Rat Protein S100-A8 (S100a8), Unconjugated
Biozol Catalog Number: BIM-RPC20079
Supplier Catalog Number: RPC20079
Alternative Catalog Number: BIM-RPC20079-20UG, BIM-RPC20079-100UG, BIM-RPC20079-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Rat
Conjugation: Unconjugated
Alternative Names: Calgranulin-AMigration inhibitory factor-related protein 8, MRP-8, p8S100 calcium-binding protein A8
Recombinant Rat Protein S100-A8 (S100a8) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus). Target Name: S100a8. Target Synonyms: Calgranulin-AMigration
Molecular Weight: 14.1kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: ATELEKALSNVIEVYHNYSGIKGNHHALYRDDFRKMVTTECPQFVQNKNTESLFKELDVNSDNAINFEEFLVLVIRVGVAAHKDSHKE
Target: S100a8