Recombinant Cat Serum amyloid A protein (SAA1), partial, Unconjugated

Product Overview

• Article Name: Recombinant Cat Serum amyloid A protein (SAA1), partial, Unconjugated
• Biozol Catalog Number: BIM-RPC20080
• Supplier Catalog Number: RPC20080
• Alternative Catalog Number: BIM-RPC20080-20UG, BIM-RPC20080-100UG, BIM-RPC20080-1MG
• Manufacturer: Biomatik Corporation
• Category: Proteine/Peptide
• Species Reactivity: Feline
• Conjugation: Unconjugated
• Alternative Names: Amyloid fibril protein AACurated

Product Description

Recombinant Cat Serum amyloid A protein (SAA1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Felis catus (Cat) (Felis silvestris catus). Target Name: SAA1. Target

Product Properties

• Molecular Weight: 24.1kDa
• Tag: N-Terminal 6Xhis-B2M-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% as determined by SDS-PAGE
• Sequence: EWYSFLGEAAQGAWDMWRAYSDMREANYIGADKYFHARGNYDAAQRGPGGAWAAKVISDARENSQRVTDFFRHGNSGHGAEDSKADQEWG
• Target: SAA1