Recombinant Human Lysine-specific demethylase 3B (KDM3B), partial, Unconjugated

Catalog Number: BIM-RPC20551
Article Name: Recombinant Human Lysine-specific demethylase 3B (KDM3B), partial, Unconjugated
Biozol Catalog Number: BIM-RPC20551
Supplier Catalog Number: RPC20551
Alternative Catalog Number: BIM-RPC20551-20UG, BIM-RPC20551-100UG, BIM-RPC20551-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: JmjC domain-containing histone demethylation protein 2BJumonji domain-containing protein 1BNuclear protein 5qNCA
Recombinant Human Lysine-specific demethylase 3B (KDM3B), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: KDM3B. Target Synonyms: J
Molecular Weight: 45.6kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: MPTRFEDLMENLPLPEYTKRDGRLNLASRLPSYFVRPDLGPKMYNAYGLITAEDRRVGTTNLHLDVSDAVNVMVYVGIPIGEGAHDEEVLKTIDEGDADEVTKQRIHDGKEKPGALWHIYAAKDAEKIRELLRKVGEEQGQENPPDHDPIHDQSWYLDQTLRKRLYEEYGVQGWAIVQFLGDAVFIPAGAPHQVHNLYSCIKVAEDFVSPEHVKHCFRLTQEFR
Target: KDM3B