Recombinant Escherichia coli Glyoxylate/hydroxypyruvate reductase A (ghrA), Unconjugated

Catalog Number: BIM-RPC20554
Article Name: Recombinant Escherichia coli Glyoxylate/hydroxypyruvate reductase A (ghrA), Unconjugated
Biozol Catalog Number: BIM-RPC20554
Supplier Catalog Number: RPC20554
Alternative Catalog Number: BIM-RPC20554-20UG, BIM-RPC20554-100UG, BIM-RPC20554-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: E. coli
Conjugation: Unconjugated
Alternative Names: 2-ketoacid reductase
Recombinant Escherichia coli Glyoxylate/hydroxypyruvate reductase A (ghrA) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Escherichia coli (strain 55989 / EAEC). Target Name
Molecular Weight: 51.4kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: MDIIFYHPTFDTQWWIEALRKAIPQARVRAWKSGDNDSADYALVWHPPVEMLAGRDLKAVFALGAGVDSILSKLQAHPEMLNPSVPLFRLEDTGMGEQMQEYAVSQVLHWFRRFDDYRIQQNSSHWQPLPEYHREDFTIGILGAGVLGSKVAQSLQTWRFPLRCWSRTRKSWPGVQSFAGREELSAFLSQCRVLINLLPNTPETVGIINQQLLEKLPDGAYLLNLARGVHVVEDDLLAALDSGKVKGAMLDVFN
Target: ghrA