Recombinant Escherichia coli K99 fimbrial protein (fanC), Unconjugated

Catalog Number: BIM-RPC20557
Article Name: Recombinant Escherichia coli K99 fimbrial protein (fanC), Unconjugated
Biozol Catalog Number: BIM-RPC20557
Supplier Catalog Number: RPC20557
Alternative Catalog Number: BIM-RPC20557-20UG, BIM-RPC20557-100UG, BIM-RPC20557-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: E. coli
Conjugation: Unconjugated
Alternative Names: fanCK99 fimbrial protein
Recombinant Escherichia coli K99 fimbrial protein (fanC) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Escherichia coli. Target Name: fanC. Target Synonyms: fanCK99 fimbria
Molecular Weight: 16.5kDa
Tag: Tag-Free
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: NTGTINFNGKITSATCTIDPEVNGNRTSTIDLGQAAISGHGTVVDFKLKPAPGSNDCLAKTNARIDWSGSMNSLGFNNTASGNTAAKGYHMTLRATNVGNGSGGANINTSFTTAEYTHTSAIQSFNYSAQLKKDDRAPSNGGYKAGVFTTSASFLVTYM
Target: fanC