Recombinant Human Arylacetamide deacetylase (AADAC), partial, Unconjugated

Product Overview

• Article Name: Recombinant Human Arylacetamide deacetylase (AADAC), partial, Unconjugated
• Biozol Catalog Number: BIM-RPC20563
• Supplier Catalog Number: RPC20563
• Alternative Catalog Number: BIM-RPC20563-20UG, BIM-RPC20563-100UG, BIM-RPC20563-1MG
• Manufacturer: Biomatik Corporation
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: AAAD_HUMAN, Aada, Aadac, Arylacetamide deacetylase (esterase), Arylacetamide deacetylase, CES5A1, DAC

Product Description

Recombinant Human Arylacetamide deacetylase (AADAC), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: AADAC. Target Synonyms: AAAD_H

Product Properties

• Molecular Weight: 63.1kDa
• Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% as determined by SDS-PAGE
• Sequence: PDNVEEPWRMMWINAHLKTIQNLATFVELLGLHHFMDSFKVVGSFDEVPPTSDENVTVTETKFNNILVRVYVPKRKSEALRRGLFYIHGGGWCVGSAALSGYDLLSRWTADRLDAVVVSTNYRLAPKYHFPIQFEDVYNALRWFLRKKVLAKYGVNPERIGISGDSAGGNLAAAVTQQLLDDPDVKIKLKIQSLIYPALQPLDVDLPSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHL
• Target: AADAC