Recombinant Human Interferon-induced helicase C domain-containing protein 1 (IFIH1), partial, Unconjugated

Catalog Number: BIM-RPC20565
Article Name: Recombinant Human Interferon-induced helicase C domain-containing protein 1 (IFIH1), partial, Unconjugated
Biozol Catalog Number: BIM-RPC20565
Supplier Catalog Number: RPC20565
Alternative Catalog Number: BIM-RPC20565-20UG, BIM-RPC20565-100UG, BIM-RPC20565-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Clinically amyopathic dermatomyositis autoantigen 140 kDaCADM-140 autoantigenHelicase with 2 CARD domainsHelicardInterferon-induced with helicase C domain protein 1Melanoma differentiation-associated protein 5MDA-5Murabutide down-regulated proteinRIG-I-l
Recombinant Human Interferon-induced helicase C domain-containing protein 1 (IFIH1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name
Molecular Weight: 53.5kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: KLTKLRNTIMEQYTRTEESARGIIFTKTRQSAYALSQWITENEKFAEVGVKAHHLIGAGHSSEFKPMTQNEQKEVISKFRTGKINLLIATTVAEEGLDIKECNIVIRYGLVTNEIAMVQARGRARADESTYVLVAHSGSGVIEHETVNDFREKMMYKAIHCVQNMKPEEYAHKILELQMQSIMEKKMKTKRNIAKHYKNNPSLITFLCKNCSVLACSGEDIHVIEKMHHVNMTPEFKELYIVRENKALQKKCAD
Target: IFIH1