Recombinant Human ATP synthase subunit alpha, mitochondrial (ATP5F1A), Unconjugated

Catalog Number: BIM-RPC20568
Article Name: Recombinant Human ATP synthase subunit alpha, mitochondrial (ATP5F1A), Unconjugated
Biozol Catalog Number: BIM-RPC20568
Supplier Catalog Number: RPC20568
Alternative Catalog Number: BIM-RPC20568-20UG, BIM-RPC20568-100UG, BIM-RPC20568-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: ATP synthase alpha chain, ATP synthase alpha chain, mitochondrial, ATP synthase subunit alpha, ATP synthase subunit alpha mitochondrial, ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit 1, cardiac muscle, ATP synthase, H+ transporti
Recombinant Human ATP synthase subunit alpha, mitochondrial (ATP5F1A) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: ATP5F1A. Target Synon
Molecular Weight: 71.2kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: QKTGTAEMSSILEERILGADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKTRRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGSDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMG
Target: ATP5F1A