Recombinant Mouse Lymphocyte antigen 6E (Ly6e), Unconjugated

Catalog Number: BIM-RPC20571
Article Name: Recombinant Mouse Lymphocyte antigen 6E (Ly6e), Unconjugated
Biozol Catalog Number: BIM-RPC20571
Supplier Catalog Number: RPC20571
Alternative Catalog Number: BIM-RPC20571-20UG, BIM-RPC20571-100UG, BIM-RPC20571-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: Stem cell antigen 2Thymic shared antigen 1
Recombinant Mouse Lymphocyte antigen 6E (Ly6e) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Ly6e. Target Synonyms: Stem cell antigen 2Th
Molecular Weight: 22.8kDa
Tag: N-Terminal 6Xhis-B2M-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA
Target: Ly6e