Recombinant Epstein-Barr virus Latent membrane protein 1 (LMP1), partial, Unconjugated

Catalog Number: BIM-RPC20572
Article Name: Recombinant Epstein-Barr virus Latent membrane protein 1 (LMP1), partial, Unconjugated
Biozol Catalog Number: BIM-RPC20572
Supplier Catalog Number: RPC20572
Alternative Catalog Number: BIM-RPC20572-20UG, BIM-RPC20572-100UG, BIM-RPC20572-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Virus
Conjugation: Unconjugated
Alternative Names: Protein p63
Recombinant Epstein-Barr virus Latent membrane protein 1 (LMP1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvi
Molecular Weight: 20.8kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: YFHGPRHTDEHHHDDSLPHPQQATDDSSHESDSNSNEGRHHLLVSGAGDGPPLCSQNLGAPGGGPDNGPQDPDNTDDNGPQDPDNTDDNGNTDDNGPQDPDNTDDNGPHDPLPHNPSDSAGNDGGPPNLTEEVENKGGDRGPPSMTDGGGGDPHLPTLLLGTSGSGGDDDDPHGPVQLSYYD
Target: LMP1