Recombinant Mouse Kallikrein-14 (Klk14), Unconjugated

Catalog Number: BIM-RPC20576
Article Name: Recombinant Mouse Kallikrein-14 (Klk14), Unconjugated
Biozol Catalog Number: BIM-RPC20576
Supplier Catalog Number: RPC20576
Alternative Catalog Number: BIM-RPC20576-20UG, BIM-RPC20576-100UG, BIM-RPC20576-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: Glandular kallikrein KLK14
Recombinant Mouse Kallikrein-14 (Klk14) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Klk14. Target Synonyms: Glandular kallikrein KLK14.
Molecular Weight: 28.5kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: IIGGYRCVRNSQPWQVALQAGPGHRFLCGGVLLSDQWVITAAHCARPILHVALGKHNIRRWEATQQVVRVARQVPHPQYQPQAHDNDLMLLKLQKKVRLGRAVKTISVASSCASPGTPCRVSGWGTIASPIARYPTALQCVNVNIMSEQACHRAYPGIITSGMVCAGVPEGGKDSCQGDSGGPLVCGGQLQGLVSWGMERCAMPGYPGVYANLCNYHSWIQRTMQSN
Target: Klk14