Recombinant Human Renin receptor (ATP6AP2), Unconjugated

Product Overview

• Article Name: Recombinant Human Renin receptor (ATP6AP2), Unconjugated
• Biozol Catalog Number: BIM-RPC20578
• Supplier Catalog Number: RPC20578
• Alternative Catalog Number: BIM-RPC20578-20UG, BIM-RPC20578-100UG, BIM-RPC20578-1MG
• Manufacturer: Biomatik Corporation
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: ATP6M8-9, V-ATPase M8.9 subunit

Product Description

Recombinant Human Renin receptor (ATP6AP2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: ATP6AP2. Target Synonyms: ATP6M8-9, V-ATPase M8.

Product Properties

• Molecular Weight: 53.5kDa
• Tag: N-Terminal 6Xhis-Sumo-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% as determined by SDS-PAGE
• Sequence: NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFD
• Target: ATP6AP2