Recombinant Human PCNA-associated factor (PCLAF), Unconjugated

Catalog Number: BIM-RPC21560
Article Name: Recombinant Human PCNA-associated factor (PCLAF), Unconjugated
Biozol Catalog Number: BIM-RPC21560
Supplier Catalog Number: RPC21560
Alternative Catalog Number: BIM-RPC21560-20UG, BIM-RPC21560-100UG, BIM-RPC21560-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Hepatitis C virus NS5A-transactivated protein 9, HCV NS5A-transactivated protein 9Overexpressed in anaplastic thyroid carcinoma 1, OEATC-1, PCNA-associated factor of 15 kDa, PAF15, p15PAF
Recombinant Human PCNA-associated factor (PCLAF) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: PCLAF. Target Synonyms: Hepatitis C virus
Molecular Weight: 39kDa
Tag: N-Terminal Gst-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE
Target: PCLAF