Recombinant Mouse Interferon regulatory factor 3 (Irf3), Unconjugated

Catalog Number: BIM-RPC24758
Article Name: Recombinant Mouse Interferon regulatory factor 3 (Irf3), Unconjugated
Biozol Catalog Number: BIM-RPC24758
Supplier Catalog Number: RPC24758
Alternative Catalog Number: BIM-RPC24758-20UG, BIM-RPC24758-100UG, BIM-RPC24758-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: IRF-3
Recombinant Mouse Interferon regulatory factor 3 (Irf3) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Irf3. Target Synonyms: IRF-3. Accessi
Molecular Weight: 50.9kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: METPKPRILPWLVSQLDLGQLEGVAWLDESRTRFRIPWKHGLRQDAQMADFGIFQAWAEASGAYTPGKDKPDVSTWKRNFRSALNRKEVLRLAADNSKDPYDPHKVYEFVTPGARDFVHLGASPDTNGKSSLPHSQENLPKLFDGLILGPLKDEGSSDLAIVSDPSQQLPSPNVNNFLNPAPQENPLKQLLAEEQWEFEVTAFYRGRQVFQQTLFCPGGLRLVGSTADMTLPWQPVTLPDPEGFLTDKLVKEYV
Target: Irf3