Recombinant Human Tyrosine-protein kinase JAK1 (JAK1), partial, Unconjugated

Product Overview

• Article Name: Recombinant Human Tyrosine-protein kinase JAK1 (JAK1), partial, Unconjugated
• Biozol Catalog Number: BIM-RPC24767
• Supplier Catalog Number: RPC24767
• Alternative Catalog Number: BIM-RPC24767-20UG, BIM-RPC24767-100UG, BIM-RPC24767-1MG
• Manufacturer: Biomatik Corporation
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: Janus kinase 1JAK-1

Product Description

Recombinant Human Tyrosine-protein kinase JAK1 (JAK1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: JAK1. Target Synonyms: Janus k

Product Properties

• Molecular Weight: 36.9kDa
• Tag: N-Terminal 6Xhis-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% as determined by SDS-PAGE
• Sequence: EQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTR
• Target: JAK1