Recombinant Human Lysosomal acid lipase/cholesteryl ester hydrolase (LIPA), Unconjugated

Catalog Number: BIM-RPC24795
Article Name: Recombinant Human Lysosomal acid lipase/cholesteryl ester hydrolase (LIPA), Unconjugated
Biozol Catalog Number: BIM-RPC24795
Supplier Catalog Number: RPC24795
Alternative Catalog Number: BIM-RPC24795-20UG, BIM-RPC24795-100UG, BIM-RPC24795-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Cholesteryl esteraseLipase ASterol esterase
Recombinant Human Lysosomal acid lipase/cholesteryl ester hydrolase (LIPA) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: LIPA. Target Synon
Molecular Weight: 45kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: SGGKLTAVDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMS
Target: LIPA