Recombinant Human Neprilysin (MME), partial, Unconjugated

Catalog Number: BIM-RPC24818
Article Name: Recombinant Human Neprilysin (MME), partial, Unconjugated
Biozol Catalog Number: BIM-RPC24818
Supplier Catalog Number: RPC24818
Alternative Catalog Number: BIM-RPC24818-20UG, BIM-RPC24818-100UG, BIM-RPC24818-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: AtriopeptidaseCommon acute lymphocytic leukemia antigen, CALLAEnkephalinaseNeutral endopeptidase 24.11, NEP, Neutral endopeptidase, Skin fibroblast elastase, SFE, CD10
Recombinant Human Neprilysin (MME), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: MME. Target Synonyms: AtriopeptidaseCommon acute
Molecular Weight: 81.8kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: YDDGICKSSDCIKSAARLIQNMDATTEPCTDFFKYACGGWLKRNVIPETSSRYGNFDILRDELEVVLKDVLQEPKTEDIVAVQKAKALYRSCINESAIDSRGGEPLLKLLPDIYGWPVATENWEQKYGASWTAEKAIAQLNSKYGKKVLINLFVGTDDKNSVNHVIHIDQPRLGLPSRDYYECTGIYKEACTAYVDFMISVARLIRQEERLPIDENQLALEMNKVMELEKEIANATAKPEDRNDPMLLYNKMTL
Target: MME